PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009799083.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Dof
Protein Properties Length: 285aa    MW: 31977.3 Da    PI: 4.3042
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009799083.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof119.81e-372280462
          zf-Dof  4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                    +a +cprC s ntkfCyynnyslsqPryfCkaCrryWtkGG+lrnvPvGgg+rk+++s+
  XP_009799083.1 22 HAPNCPRCASINTKFCYYNNYSLSQPRYFCKACRRYWTKGGSLRNVPVGGGCRKSRRSR 80
                    6779***************************************************9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-27873IPR003851Zinc finger, Dof-type
PfamPF027011.8E-322378IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.5092478IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102662IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MLAFPSRPMI MMERNRKSNV EHAPNCPRCA SINTKFCYYN NYSLSQPRYF CKACRRYWTK  60
GGSLRNVPVG GGCRKSRRSR STRKDDNNLL MPNPALSGNE AAGADIDLAD VFAKYVNQGT  120
TNDHDQDNIL QESPLANQDY CSIGASLSNS PSLDSLVNPS SFENESQVDE TIIMGNYQDY  180
PCGFLQEEQI QGGGSIHEVS GQDFLDFNPS SFVEMQAMLG DEIMGQGEEF DYNTSLAWQP  240
MMQFQEFGSI LEDDDQLKIS TENLDSHNNY GSSFDLTSYE IVTRP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009799083.10.0PREDICTED: dof zinc finger protein DOF2.4-like
SwissprotQ9SVC53e-41DOF35_ARATH; Dof zinc finger protein DOF3.5
TrEMBLM0ZJJ71e-115M0ZJJ7_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000020601e-115(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52440.11e-36Dof family protein